You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb585497 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CD86 |
| Target | CD86 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Porcine |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Protein Sequence | Synthetic peptide located within the following region: DVTSNMTIFCILETDKTRLLSSPFSIGTNTMEREESEQTKKREKIHIPER |
| UniProt ID | P42081 |
| MW | 30kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | B70, B7-2, B7.2, LAB72, CD28LG2 |
| Research Area | Epigenetics & Chromatin, Immunology & Inflammation Read more... |
| Note | For research use only |
| NCBI | NP_795711 |
| Expiration Date | 12 months from date of receipt. |

WB Suggested Anti-CD86 Antibody, Titration: 1.0 ug/ml, Positive Control: COLO205 Whole Cell.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Porcine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF | |
Bovine, Canine, Porcine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE |
FC, IF | |
Bovine, Canine, Porcine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
APC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review