CD69 Rabbit Polyclonal Antibody

SKU: orb585505

Description

CD69 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting CD69. It is suitable for WB and is reactive with human samples. Predicted reactivity includes Canine, Guinea pig, Mouse, Rat. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine, Guinea pig, Mouse, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: CD69
• Protein Sequence: Synthetic peptide located within the following region: FISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKK
• Molecular Weight: 22kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

AIM, EA1, MLR-3, CLEC2C, GP32/28, BL-AC/P26

WB Suggested Anti-CD69 Antibody, Titration: 1.0 ug/ml, Positive Control: HCT15 Whole Cell.

Quick Database Links

Gene Symbol

CD69

UniProt

Q07108

RefSeq (Protein):NP_001772