CD69 Rabbit Polyclonal Antibody

• Catalog Number: orb585505
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CD69
• Target: CD69
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Guinea pig, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: FISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKK
• UniProt ID: Q07108
• MW: 22kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: AIM, EA1, MLR-3, CLEC2C, GP32/28, BL-AC/P26
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_001772

WB Suggested Anti-CD69 Antibody, Titration: 1.0 ug/ml, Positive Control: HCT15 Whole Cell.