CD63 Antibody

• Catalog Number: orb11597
• Category: Antibodies
• Description: CD63 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of the members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. These proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker.
• Target: Lysosome-associated membrane glycoprotein 3
• Clonality: Polyclonal
• Species/Host: Goat
• Isotype: IgG
• Conjugation: Unconjugated
• Reactivity: Canine, Human, Monkey, Mouse, Rat
• Concentration: 1 mg/ml
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Purification: Epitope affinity purified
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli.. Antigen Sequence: MENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCI
• Tested applications: IF, IHC-Fr, IHC-P, WB
• Dilution range: WB:1:500-1:5,000, IF:1:25-1:250, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000
• Application notes: The antibody solution should be gently mixed before use.
• Antibody Type: Primary Antibody
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CD63 antigen, CD63 antigen (melanoma 1 antigen), g
• Note: For research use only

References

Liu, Dishiwen et al. Cardiac Fibroblasts Promote Ferroptosis in Atrial Fibrillation by Secreting Exo-miR-23a-3p Targeting SLC7A11 Oxid Med Cell Longev, 2022, 3961495 (2022)

PubMed: 35677105

Western blot analysis of AtT-20 and Jurkat cell lysate using CD63 antibody

Confocal immunofluorescence analysis of Hepa1-6 cells using CD63 antibody