You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb588905 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CD46 |
| Target | CD46 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CD46 |
| Protein Sequence | Synthetic peptide located within the following region: VLCTPPPKIKNGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIGESTIY |
| UniProt ID | P15529 |
| MW | 36 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | MCP, TLX, AHUS2, MIC10, TRA2.10 |
| Research Area | Epigenetics, Immunology, Infectious Diseases |
| Note | For research use only |
| NCBI | NP_002380.3 |

Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human COLO205 Whole Cell lysates, Antibody Dilution: 1 ug/ml.
FC, IF, IHC-Fr, IHC-P, WB | |
Mouse | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review