Cart summary

You have no items in your shopping cart.

CD4 Rabbit Polyclonal Antibody

SKU: orb331017

Description

Rabbit polyclonal antibody to CD4

Research Area

Cell Biology, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CD4
TargetCD4
Protein SequenceSynthetic peptide located within the following region: VLGGVAGLLLFIGLGIFFCVRCRHRRRQAERMSQIKRLLSEKKTCQCPHR
Molecular Weight48kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Anti-CD 4 antibody, Anti-CD4 (L3T4) antibody, Anti-CD4 antibody, Anti-CD4 antigen (p55) antibody, Anti-CD4 antigen antibody, Anti-CD4 molecule antibody, Anti-CD4 receptor antibody, Anti-CD4+ Lymphocyte deficiency, included antibody, Anti-CD4_HUMAN antibody, Anti-CD4mut antibody, Anti-L3T4 antibody, Anti-Leu3 antibody, Anti-Ly-4 antibody, Anti-Lymphocyte antigen CD4 antibody, Anti-MGC165891 antibody, Anti-OTTHUMP00000238897 antibody, Anti-p55 antibody, Anti-T cell antigen T4 antibody, Anti-T cell antigen T4/LEU3 antibody, Anti-T cell differentiation antigen L3T4 antibody, Anti-T cell OKT4 deficiency, included antibody, Anti-T cell surface antigen T4/Leu 3 antibody, Anti-T cell surface antigen T4/Leu3 antibody, Anti-T cell surface glycoprotein CD4 antibody, Anti-T-cell surface antigen T4/Leu-3 antibody, Anti-T-cell surface glycoprotein CD4 antibody, Anti-W3/25 antibody, Anti-W3/25 antigen antibody

Similar Products

  • CD4 Rabbit Polyclonal Antibody [orb182470]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Guinea pig, Rat, Sheep

    Human, Mouse, Porcine

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • CD4 Rabbit Polyclonal Antibody [orb312176]

    IF,  IHC-Fr,  IHC-P,  WB

    Human, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • CD4 rabbit pAb Antibody [orb764784]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl
  • CD4 (phospho Ser433) rabbit pAb Antibody [orb770862]

    ELISA,  IF,  IHC

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • CD4 (pS433) Antibody [orb2649548]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CD4 Rabbit Polyclonal Antibody

WB Suggested Anti-CD4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000607

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

CD4 Rabbit Polyclonal Antibody (orb331017)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry