You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb580287 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CD36 |
| Target | CD36 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CD36 |
| Protein Sequence | Synthetic peptide located within the following region: MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIA |
| UniProt ID | P16671 |
| MW | 53kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | FAT, GP4, GP3B, GPIV, CHDS7, PASIV, SCARB3, BDPLT1 Read more... |
| Research Area | Cell Biology, Epigenetics & Chromatin, Immunology Read more... |
| Note | For research use only |
| NCBI | NP_001001547 |
| Expiration Date | 12 months from date of receipt. |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 32 kDa.

Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Immunohistochemistry with HepG2 cell lysate tissue at an antibody concentration of 1 ug/ml using anti-CD36 antibody (orb580287).

Rabbit Anti-CD36 Antibody, Paraffin Embedded Tissue: Human hepatocyte, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-CD36 Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate.
FC, IF, IHC-Fr, IHC-P, IP, WB | |
Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-P, WB | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |