CD34 Rabbit Polyclonal Antibody

• Catalog Number: orb584866
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CD34
• Target: CD34
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CD34
• Protein Sequence: Synthetic peptide located within the following region: DLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRR
• UniProt ID: Q3C1E7
• MW: 35kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001764

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Human kidney, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Color/Signal Descriptions: Brown: CD34 Blue: DAPI, Gene Name: CD34.

WB Suggested Anti-CD34 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Heart.