Cct7 Rabbit Polyclonal Antibody

• Catalog Number: orb581456
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Cct7
• Target: Cct7
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: FVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDPPAPSAGRGRGQ
• UniProt ID: P80313
• MW: 60kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Ccth, Cctz, AA408524, AL022769
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_031664
• Expiration Date: 12 months from date of receipt.

Sample Type: HEK 293 (10 ug), Primary dilution: 1:1000, Secondary Antibody: conjugated goat anti-rabbit, Secondary dilution: 1:10000.

Cct7 antibody - C-terminal region (orb581456) validated by WB using 293T cells lysate at 1:1000 dilution for antibody samples and 1:10000 for secondary antibodies.