You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581455 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CCT7 |
Target | CCT7 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CCT7 |
Protein Sequence | Synthetic peptide located within the following region: RAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPR |
UniProt ID | Q99832 |
MW | 60kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CCTH, CCTETA, NIP7-1, TCP1ETA |
Research Area | Cell Biology |
Note | For research use only |
NCBI | NP_006420 |
Expiration Date | 12 months from date of receipt. |
Sample Type: HEK 293 (10 ug), Primary dilution: 1:1000, Secondary Antibody: conjugated goat anti-rabbit, Secondary dilution: 1:10000, CCT7 is supported by BioGPS gene expression data to be expressed in HEK293T.
Rabbit Anti-CCT7 Antibody, Catalog Number: orb581455, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-CCT7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate. CCT7 is supported by BioGPS gene expression data to be expressed in HEK293T.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |