CCT7 Rabbit Polyclonal Antibody

• Catalog Number: orb581455
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CCT7
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCT7
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 60kDa
• Target: CCT7
• UniProt ID: Q99832
• Protein Sequence: Synthetic peptide located within the following region: RAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPR
• NCBI: NP_006420
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CCTH, CCTETA, NIP7-1, TCP1ETA
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: HEK 293 (10 ug), Primary dilution: 1:1000, Secondary Antibody: conjugated goat anti-rabbit, Secondary dilution: 1:10000, CCT7 is supported by BioGPS gene expression data to be expressed in HEK293T.

Rabbit Anti-CCT7 Antibody, Catalog Number: orb581455, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-CCT7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate. CCT7 is supported by BioGPS gene expression data to be expressed in HEK293T.