CCT4 Rabbit Polyclonal Antibody

• Catalog Number: orb575008
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CCT4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Yeast, Zebrafish
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CCT4
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58kDa
• Target: CCT4
• UniProt ID: Q53QP9
• Protein Sequence: Synthetic peptide located within the following region: AFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISN
• NCBI: NP_006421
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SRB, Cctd, CCT-DELTA
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CCT4 antibody - C-terminal region (orb575008) validated by WB using 293T cells lysate. CCT4 is supported by BioGPS gene expression data to be expressed in HEK293T.

Lanes: Lane 1: Negative control (anti-FLAG antibody), Lane 2: Immunoprecipitation with CCT4 (C-term), Lane 3: 10 ug lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-rabbit, Secondary Antibody dilution: 1:10000, Gene Name: CCT4, CCT4 is supported by BioGPS gene expression data to be expressed in HEK293T.

Sample Type: Rat Hippocampal Neurons - 14DIV Primary Antibody Dilution: 1:200 Secondary Antibody: Anti-rabbit-Cy3 Secondary Antibody Dilution: 1:500 Color/Signal Descriptions : White: CCT4 Gene Name : CCT4.

WB Suggested Anti-CCT4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate, CCT4 is supported by BioGPS gene expression data to be expressed in HepG2.