CCT4 Rabbit Polyclonal Antibody

• Catalog Number: orb575007
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CCT4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Yeast, Zebrafish
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CCT4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58kDa
• Target: CCT4
• UniProt ID: Q53QP9
• Protein Sequence: Synthetic peptide located within the following region: AFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISN
• NCBI: NP_006421
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SRB, Cctd, CCT-DELTA
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.

Rabbit Anti-CCT4 Antibody, Catalog Number: orb575007, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Sample Type: Rat Hippocampal Neurons - 14DIV, Primary Antibody dilution: 1:200, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody dilution: 1:500, Color/Signal Descriptions: White: CCT4, Gene Name: CCT4.