You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581179 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CCNL2 |
Target | CCNL2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CCNL2 |
Protein Sequence | Synthetic peptide located within the following region: TGQVLFQRFFYTKSFVKHSMEHVSMACVHLASKIEEAPRRIRDVINVFHR |
UniProt ID | Q96S94 |
MW | 58kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CCNM, CCNS, PCEE, SB138, ANIA-6B, HLA-ISO, HCLA-IS Read more... |
Note | For research use only |
NCBI | NP_001034666 |
WB Suggested Anti-CCNL2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. CCNL2 is supported by BioGPS gene expression data to be expressed in Jurkat.
WB Suggested Anti-CCNL2 Antibody Titration: 1 ug/ml, Positive Control: Human placenta.
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Biotin |