Cart summary

You have no items in your shopping cart.

CCNL2 Rabbit Polyclonal Antibody (Biotin)

CCNL2 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2111368

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2111368
CategoryAntibodies
DescriptionCCNL2 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CCNL2
Protein SequenceSynthetic peptide located within the following region: TGQVLFQRFFYTKSFVKHSMEHVSMACVHLASKIEEAPRRIRDVINVFHR
UniProt IDQ96S94
MW58kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesCCNM, CCNS, PCEE, SB138, ANIA-6B, HLA-ISO, HCLA-IS
Read more...
NoteFor research use only
NCBINP_001034666