You have no items in your shopping cart.
Cart summary
Item 1 of 1
Ccl20 Rabbit Polyclonal Antibody
Catalog Number: orb329582
| Catalog Number | orb329582 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to Ccl20 |
| Target | Ccl20 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Rat |
| Predicted Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rabbit |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Rat |
| Protein Sequence | Synthetic peptide located within the following region: CCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQI |
| UniProt ID | P97884 |
| MW | 11kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti ST38 antibody, anti Scya20 antibody, anti Ccl Read more... |
| Note | For research use only |
| NCBI | NP_062106 |
WB Suggested Anti-Ccl20 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Rat Heart.
- Item 1 of 1
CCL20 Rabbit Polyclonal Antibody [orb10264]
IF, IHC-Fr, IHC-P
Rat
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
