CCL18 Rabbit Polyclonal Antibody

• Catalog Number: orb592730
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CCL18
• Target: CCL18
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCL18
• Protein Sequence: Synthetic peptide located within the following region: PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
• UniProt ID: P55774
• MW: 10kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CKb7, PARC, AMAC1, DCCK1, MIP-4, AMAC-1, DC-CK1, S
• Research Area: Cell Biology, Immunology & Inflammation, Signal Tr
• Note: For research use only
• NCBI: NP_002979
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: Fetal Lung lysates, Antibody Dilution: 0.5 ug/ml.

Sample Type: Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.

Sample Type: Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.

Positive control (+): Human lung (LU), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml.

Human Intestine