You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592730 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CCL18 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CCL18 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 10kDa |
Target | CCL18 |
UniProt ID | P55774 |
Protein Sequence | Synthetic peptide located within the following region: PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
NCBI | NP_002979 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CKb7, PARC, AMAC1, DCCK1, MIP-4, AMAC-1, DC-CK1, S Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Type: Fetal Lung lysates, Antibody Dilution: 0.5 ug/ml.
Sample Type: Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.
Sample Type: Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.
Positive control (+): Human lung (LU), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml.
Human Intestine
IF, IHC-Fr, IHC-P | |
Human | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |