Cart summary

You have no items in your shopping cart.

CCL18 Rabbit Polyclonal Antibody (FITC)

CCL18 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2081238

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2081238
CategoryAntibodies
DescriptionCCL18 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CCL18
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW10kDa
UniProt IDP55774
Protein SequenceSynthetic peptide located within the following region: PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
NCBINP_002979
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesCKb7, PARC, AMAC1, DCCK1, MIP-4, AMAC-1, DC-CK1, S
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.