CC2D2A Rabbit Polyclonal Antibody

• Catalog Number: orb326553
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CC2D2A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Guinea pig, Mouse
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CC2D2A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 14kDa
• Target: CC2D2A
• UniProt ID: E7EP21
• Protein Sequence: Synthetic peptide located within the following region: EDADMGRQNKNSKVRRQPRKKQKPTPFSRACWQILPHLSAGVPLLGWEHP
• NCBI: NP_065836
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti JBTS9 antibody, anti KIAA1345 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-CC2D2A Antibody, Titration: 1.0 ug/mL, Positive Control: MDA-MB-435S Whole Cell.