You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326553 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CC2D2A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Guinea pig, Mouse |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human CC2D2A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 14kDa |
Target | CC2D2A |
UniProt ID | E7EP21 |
Protein Sequence | Synthetic peptide located within the following region: EDADMGRQNKNSKVRRQPRKKQKPTPFSRACWQILPHLSAGVPLLGWEHP |
NCBI | NP_065836 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti JBTS9 antibody, anti KIAA1345 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-CC2D2A Antibody, Titration: 1.0 ug/mL, Positive Control: MDA-MB-435S Whole Cell.
ELISA, IF, IHC, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Guinea pig, Human, Mouse | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Guinea pig, Human, Mouse | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Guinea pig, Human, Mouse | |
Rabbit | |
Polyclonal | |
Biotin |