Cart summary

You have no items in your shopping cart.

CC2D2A Rabbit Polyclonal Antibody (Biotin)

CC2D2A Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2091199

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2091199
CategoryAntibodies
DescriptionCC2D2A Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityGuinea pig, Human, Mouse
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human CC2D2A
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW14kDa
UniProt IDE7EP21
Protein SequenceSynthetic peptide located within the following region: EDADMGRQNKNSKVRRQPRKKQKPTPFSRACWQILPHLSAGVPLLGWEHP
NCBINP_065836
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesMKS6, JBTS9, COACH2
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.