You have no items in your shopping cart.
Cathepsin D Antibody
Description
Images & Validation
−| Tested Applications | IEM, IF, IHC-Fr, IHC-P, WB |
|---|---|
| Dilution Range | WB:1:250-1:1,000, IF:1:50-1:200, IHC-P:1:200-1:1,000, IHC-F:1:200-1:1,000, IEM:1:50-1:200 |
| Reactivity | Canine, Human, Monkey, Mouse, Rat |
| Application Notes |
Key Properties
−| Antibody Type | Primary Antibody |
|---|---|
| Host | Goat |
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. Antigen Sequence: DQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL |
| Target | Cathepsin D |
| Purification | Epitope affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
| Concentration | 1 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−CTSD Antibody [orb1410244]
IHC, WB
Human
Mouse
Monoclonal
Unconjugated
20 μg, 100 μg, 100 μg (without BSA and Azide)

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Western blot analysis of CTSD and 293FT cell line lysate using Cathepsin D antibody.

Immunohistochemical analysis of formalin-fixed paraffin embedded mouse lung tissue using Cathepsin D antibody.

Immunohistochemical analysis of Cathepsin D antibody
Quick Database Links
Documents Download
Request a Document
Protocol Information
Feng, Xu et al. Genome-wide differential expression profiling of mRNAs and lncRNAs associated with prolificacy in Hu sheep Biosci Rep, 38, (2018)
Cathepsin D Antibody (orb180468)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


















