You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
| Catalog Number | orb180468 |
|---|---|
| Category | Antibodies |
| Description | Goat polyclonal antibody to Cathepsin D. Cathepsin D is a lysosomal aspartic protease of the pepsin family. Acid protease active in intracellular protein breakdown. It is composed of a dimer of disulphide-linked heavy and light chains, both produced from a single protein precursor. It is involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease. |
| Target | Cathepsin D |
| Clonality | Polyclonal |
| Species/Host | Goat |
| Isotype | IgG |
| Conjugation | Unconjugated |
| Reactivity | Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep |
| Concentration | 1 mg/ml |
| Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
| Immunogen | Antigen: Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli.. Antigen Sequence: DQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL |
| Tested applications | IEM, IF, IHC-Fr, IHC-P, WB |
| Dilution range | WB:1:250-1:1,000, IF:1:50-1:200, IHC-P:1:200-1:1,000, IHC-F:1:200-1:1,000, IEM:1:50-1:200 |
| Application notes | The antibody solution should be gently mixed before use. |
| Antibody Type | Primary Antibody |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | ceroid-lipofuscinosis, CLN10; CPSD, CTSD, lysosoma Read more... |
| Note | For research use only |
Feng, Xu et al. Genome-wide differential expression profiling of mRNAs and lncRNAs associated with prolificacy in Hu sheep Biosci Rep, 38, (2018)
Western blot analysis of CTSD and 293FT cell line lysate using Cathepsin D antibody.
Immunohistochemical analysis of formalin-fixed paraffin embedded mouse lung tissue using Cathepsin D antibody.
Immunohistochemical analysis of Cathepsin D antibody
- Item 1 of 6
- Item 1 of 6
- Item 1 of 6
- Item 1 of 6
- Item 1 of 6
