Cathepsin D Antibody

SKU: orb180468

Description

Goat polyclonal antibody to Cathepsin D. Cathepsin D is a lysosomal aspartic protease of the pepsin family. Acid protease active in intracellular protein breakdown. It is composed of a dimer of disulphide-linked heavy and light chains, both produced from a single protein precursor. It is involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.

Images & Validation

• Tested Applications: IEM, IF, IHC-Fr, IHC-P, WB
• Dilution range: WB:1:250-1:1,000, IF:1:50-1:200, IHC-P:1:200-1:1,000, IHC-F:1:200-1:1,000, IEM:1:50-1:200
• Reactivity: Canine, Human, Monkey, Mouse, Rat
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli.. Antigen Sequence: DQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
• Target: Cathepsin D
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Disclaimer: For research use only

Alternative Names

ceroid-lipofuscinosis, CLN10; CPSD, CTSD, lysosomal aspartyl protease, lysosomal aspartyl peptidase, neuronal 10 antibody.

Western blot analysis of CTSD and 293FT cell line lysate using Cathepsin D antibody.

Immunohistochemical analysis of formalin-fixed paraffin embedded mouse lung tissue using Cathepsin D antibody.

Immunohistochemical analysis of Cathepsin D antibody

Quick Database Links

Gene Symbol

Cathepsin D

References

Feng, Xu et al. Genome-wide differential expression profiling of mRNAs and lncRNAs associated with prolificacy in Hu sheep Biosci Rep, 38, (2018)

PubMed: 29439142