Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Cathepsin D Antibody

SKU: orb180468

Description

Goat polyclonal antibody to Cathepsin D. Cathepsin D is a lysosomal aspartic protease of the pepsin family. Acid protease active in intracellular protein breakdown. It is composed of a dimer of disulphide-linked heavy and light chains, both produced from a single protein precursor. It is involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.

Images & Validation

Tested ApplicationsIEM, IF, IHC-Fr, IHC-P, WB
Dilution RangeWB:1:250-1:1,000, IF:1:50-1:200, IHC-P:1:200-1:1,000, IHC-F:1:200-1:1,000, IEM:1:50-1:200
ReactivityCanine, Human, Monkey, Mouse, Rat
Application Notes
The antibody solution should be gently mixed before use.

Key Properties

HostGoat
ClonalityPolyclonal
IsotypeIgG
ImmunogenAntigen: Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. Antigen Sequence: DQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
TargetCathepsin D
PurificationEpitope affinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/AppearancePolyclonal antibody supplied as a 200 or 500 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
ConcentrationPlease inquire
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ceroid-lipofuscinosis, CLN10; CPSD, CTSD, lysosomal aspartyl protease, lysosomal aspartyl peptidase, neuronal 10 antibody.

Similar Products

  • CTSD Antibody [orb1410244]

    IHC,  WB

    Human

    Mouse

    Monoclonal

    Unconjugated

    20 μg, 100 μg, 100 μg (without BSA and Azide)
  • Hamster Cathepsin D (CTSD) ELISA Kit [orb1146816]

    Hamster

    0.16-10 ng/mL

    0.059 ng/mL

    48 T, 96 T
  • Human Cathepsin D (CTSD) ELISA Kit [orb777165]

    Human

    0.16-10 ng/mL

    0.057 ng/mL

    48 T, 96 T
  • Mouse Cathepsin D (CTSD) ELISA Kit [orb777166]

    Mouse

    0.16-10 ng/mL

    0.056 ng/mL

    48 T, 96 T
  • Rat Cathepsin D (CTSD) ELISA Kit [orb780096]

    Rat

    62.5-4000 pg/mL

    28.5 pg/mL

    48 T, 96 T
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Cathepsin D Antibody

Western blot analysis of CTSD and 293FT cell line lysate using Cathepsin D antibody.

Cathepsin D Antibody

Immunohistochemical analysis of formalin-fixed paraffin embedded mouse lung tissue using Cathepsin D antibody.

Cathepsin D Antibody

Immunohistochemical analysis of Cathepsin D antibody

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol
IHC-Fr
Immunohistochemistry Frozen
View Protocol
IF
Immunofluorescence
View Protocol

Cathepsin D Antibody (orb180468)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 280.00
1.5 mg
$ 1,090.00
Choose Conjugation or Carrier Free Version
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 2-3 days
Bulk Enquiry