You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | ChIP, IF, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human BRD4 |
| Target | BRD4 |
| Protein Sequence | Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS |
| Molecular Weight | 152 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−BRD4 Rabbit Polyclonal Antibody [orb666146]
IF, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl, 30 μlBRD4 Rabbit Polyclonal Antibody [orb1098040]
FC, ICC, IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgBRD4 Rabbit Polyclonal Antibody [orb574904]
WB
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
Human
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide sequence is contained within Isoform A (152 kDa), Isoform B (88 kDa) and isoform C (80 kDa).

Chromatin Immunoprecipitation (ChIP) Using BRD4 antibody - C-terminal region (orb576955) and HCT116 Cells.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: HeLa, Primary Antibody Dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody Dilution: 2 ug/ml, Gene Name: BRD4.

WB Suggested Anti-BRD4 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Thymus.
Documents Download
Request a Document
Protocol Information
BRD4 Rabbit Polyclonal Antibody (orb576955)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review![Anti-BRD4 [RAB-C131]](/images/pub/media/catalog/product/NewWebsite/35/orb1089958_1.png)
![Anti-BRD4 [RAB-C131]](/images/pub/media/catalog/product/NewWebsite/35/orb1089958_2.png)
![Anti-BRD4 [RAB-C131]](/images/pub/media/catalog/product/NewWebsite/35/orb1089958_3.png)









