BRD4 Rabbit Polyclonal Antibody

SKU: orb576955

Description

Rabbit polyclonal antibody to BRD4

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Protein Biochemistry, Signal Transduction

Images & Validation

−

Item 1 of 7

Tested Applications	ChIP, IF, WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human BRD4
Target	BRD4
Protein Sequence	Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS
Molecular Weight	152 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

CAP, MCAP, HUNK1, HUNKI

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide sequence is contained within Isoform A (152 kDa), Isoform B (88 kDa) and isoform C (80 kDa).

Chromatin Immunoprecipitation (ChIP) Using BRD4 antibody - C-terminal region (orb576955) and HCT116 Cells.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: HeLa, Primary Antibody Dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody Dilution: 2 ug/ml, Gene Name: BRD4.

WB Suggested Anti-BRD4 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Thymus.

Quick Database Links

Gene Symbol

BRD4

UniProt

O60885

RefSeq (Protein):NP_055114

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_055114

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Immunofluorescence

View Protocol

ChIP

Chromatin Immunoprecipitation

View Protocol

Find More Protocols