You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb576955 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to BRD4 |
| Target | BRD4 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human BRD4 |
| Protein Sequence | Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS |
| UniProt ID | O60885 |
| MW | 152 kDa |
| Tested applications | ChIP, IF, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CAP, MCAP, HUNK1, HUNKI |
| Research Area | Cancer Biology, Cell Biology, Epigenetics & Chroma Read more... |
| Note | For research use only |
| NCBI | NP_055114 |

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide sequence is contained within Isoform A (152 kDa), Isoform B (88 kDa) and isoform C (80 kDa).

Chromatin Immunoprecipitation (ChIP) Using BRD4 antibody - C-terminal region (orb576955) and HCT116 Cells.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: HeLa, Primary Antibody Dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody Dilution: 2 ug/ml, Gene Name: BRD4.

WB Suggested Anti-BRD4 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Thymus.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review