BRCC3 Rabbit Polyclonal Antibody

• Catalog Number: orb585188
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BRCC3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: BRCC3
• UniProt ID: P46736
• Protein Sequence: Synthetic peptide located within the following region: HNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQEL
• NCBI: NP_077308
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: C6.1A, BRCC36, CXorf53
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. BRCC3 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.

Sample Type: MCF7, Primary Antibody dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody dilution: 2 ug/ml, Gene Name: BRCC3.

WB Suggested Anti-BRCC3 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Heart.