You have no items in your shopping cart.
Cart summary
Item 1 of 1
Bovine TMPRSS15 protein
Catalog Number: orb605374
| Catalog Number | orb605374 |
|---|---|
| Category | Proteins |
| Description | Recombinant Bovine Enteropeptidase(TMPRSS15),partial |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 28.3 kDa |
| UniProt ID | P98072 |
| Protein Sequence | IVGGSDSREGAWPWVVALYFDDQQVCGASLVSRDWLVSAAHCVYGRNMEPSKWKAVLGLHMASNLTSPQIETRLIDQIVINPHYNKRRKNNDIAMMHLEMKVNYTDYIQPICLPEENQVFPPGRICSIAGWGALIYQGSTADVLQEADVPLLSNEKCQQQMPEYNITENMVCAGYEAGGVDSCQGDSGGPLMCQENNRWLLAGVTSFGYQCALPNRPGVYARVPRFTEWIQSFLH |
| Protein Length | Partial |
| Source | Yeast |
| Biological Origin | Bos taurus (Bovine) |
| Expression Region | 801-1035 |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Enterokinase Serine protease 7 Transmembrane prote Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Bovine TMPRSS15 Protein, His Tag [orb2701997]
> 95%, determined by SDS-PAGE
This protein contains the bovine TMPRSS15 (NP_7768641) (Ile801-His1035) was expressed with a polyhistidine tag at the C-terminus and expressed from Yeast.
20 μg, 10 μg
