Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Bovine IL-1 beta protein

SKU: orb1216331

Description

The Bovine IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-1 beta Specifications: (Molecular Weight: 17.7 kDa) (Amino Acid Sequence: APVQSIKCKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP) (Gene ID: 281251).

Research Area

Immunology & Inflammation

Images & Validation

Key Properties

SourceYeast
Biological OriginBovine
TargetIL-1 beta
Protein Length153.0
MW17.7 kDa
Purity98%
Protein SequenceAPVQSIKCKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

IL-1F2

Similar Products

  • Bovine PTX3 (Pentraxin 3) ELISA Kit [orb1881644]

    Bovine

    0.156-10ng/ml

    0.094ng/ml

    96 T, 48 T
  • Bovine IL-1b protein [orb633353]

    ELISA,  WB

    Greater than 95% by SDS-PAGE gel analyses

    17.7 KDa

    E.Coli

    50 μg, 1 mg, 100 μg, 200 μg
  • Bovine IL-1 beta protein [orb1215715]

    98%

    17.7 kDa

    Yeast

    10 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Bovine IL-1 beta protein (orb1216331)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 300.00
25 μg
$ 540.00
100 μg
$ 1,340.00
500 μg
$ 4,260.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry