Bone Morphogenetic Protein 4, BMP4

SKU: orb3148691

Description

Recombinant mature human BMP4 is produced in HEK293 cells using stable mammalian expression. This tag-free, liquid-formulated, research-grade protein is purified through a gentle mixed-mode chromatography process designed to preserve its native structure and biological activity. It is suitable for stem cell differentiation, developmental biology, organoid workflows, lineage specification, and media development applications. (Tested applications: Functional studies, ImmunoAssay, Western Blot.)

Research Area

Stem Cell & Developmental Biology; Musculoskeletal & Connective Tissue Research

Images & Validation

• Tested Applications: FA, WB
• Application Notes:
  Biologically active and independently validated against human BMP4 from R&D Systems in two differentiation models. 1. In a cardiac differentiation model, Daresbury BMP4 supported beating embryoid body formation and NKX2.5-GFP expression at 11 ng/mL, compared with 25 ng/mL for the commercial reference under the reported conditions. 2. In day-5 trophoblast differentiation of MAN13 hESCs at 10 ng/mL, this product induced CDX2, GATA3, KRT7, and TFAP2A expression by 1540-, 2350-, 7.69-, and 4542-fold, respectively, relative to the untreated control (= 1). These responses corresponded to approximately 90%, 122%, 88%, and 88% of the R&D Systems reference response, respectively.

Key Properties

• Expression System: HEK293 Cells
• Biological Origin: Human
• Tag: No tag
• Expression Region: 293-408 aa
• Purification: Mixed-mode chromatography
• MW: 13 kDa
• Purity: >95%
• Protein Sequence: SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Storage & Handling

• Storage: 4°C for short-term and -70°/80°C long-term
• Form/Appearance: Liquid (Sterile-filtered)
• Buffer/Preservatives: 20mM histidine pH 5.5, 0.2M NaCl, 0.6M arginine
• Expiration Date: 6 months from date of receipt.
• Dry Ice Shipping: Please note: This product requires shipment on dry ice. A dry ice surcharge will apply.
• Disclaimer: For research use only

Alternative Names

Bone Morphogenetic Protein 4, BMP4, BMP-4, BMP2B, BMP-2B, ZYME, DVR4

SDS-PAGE gel analysis of orb3148691.

1. BMP4 Reducing. 2. MW (NEB P7719) 5uL. 3. 175V for 45minutes (Biorad Mini-Protean TGX 4-20%, 10well 50uL). Gel samples were made 50uL sample + 10ul 6x(NON) reducing Laemmli. Loading aiming for ~2ug.

Quick Database Links

UniProt

P12644