BID Rabbit Polyclonal Antibody

• Catalog Number: orb584879
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BID
• Target: BID
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Canine, Equine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: LRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASH
• UniProt ID: B3KT21
• MW: 27kDa
• Tested applications: IF, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: FP497
• Research Area: Cancer Biology, Cell Biology, Epigenetics & Chroma
• Note: For research use only
• NCBI: NP_932070
• Expiration Date: 12 months from date of receipt.

Sample Type: Rat thyrocytes-FRTL-5, Primary Antibody dilution: 1:100, Secondary Antibody: Anti-rabbit-FITC, Secondary Antibody dilution: 1:100, Color/Signal Descriptions: Green: BID Blue: DAPI, Gene Name: BID.

WB Suggested Anti-BID Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.