Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Bacterial HRP1 protein
Catalog Number orb418912
ReactivityBacteria
ConjugationUnconjugated
Tested applicationsSDS-PAGE
Target HRP1
Product Properties
Form/Appearance Lyophilized: Tris-based buffer, 50% glycerol
Storage Store at 6 months at -20°C to -80°C.
Note For research use only.
Protein Sequence MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS
Purity >90% as determined by SDS-PAGE.
MW 35.5 kDa
Source E.coli
Uniprot ID P9WJA3
Product Description

Recombinant Mycobacterium tuberculosis Hypoxic response 1

Application Notes
Application Notes Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region: 1-143aa
Sequence Info: Full Length of Mature Protein
Reviews
Write Your Own Review
You're reviewing:Bacterial HRP1 protein - orb418912
Your Rating