You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
Bacterial APT protein
Catalog Number: orb419282
| Catalog Number | orb419282 |
|---|---|
| Category | Proteins |
| Description | Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 22.7 kDa |
| UniProt ID | P63546 |
| Protein Sequence | MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG |
| Protein Length | Full Length |
| Source | Baculovirus |
| Biological Origin | Streptococcus pyogenes serotype M1 |
| Expression Region | 1-172aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | apt, SPy_0927, M5005_Spy0728Adenine phosphoribosyl Read more... |
| Note | For research use only |
| Application notes | Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-172aaSequence Info: Partial |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M1apt.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M1apt.
- Item 1 of 1
Bacterial APT protein [orb419111]
Greater than 90% as determined by SDS-PAGE.
22.7 kDa
Yeast
20 μg, 100 μg, 1 mg
