Bacterial alpha-amylase inhibitor HOE-467A protein

SKU: orb419136

Description

This Bacterial alpha-amylase inhibitor HOE-467A protein spans the amino acid sequence from region 31-104aa. Purity: Greater than 85% as determined by SDS-PAGE.

Research Area

Infectious Disease & Virology; Pharmacology & Drug Discovery

Images & Validation

• Application Notes:
  Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 31-104aaSequence Info: Extracellular Domain

Key Properties

• Source: E.coli
• Biological Origin: Streptomyces tendae
• Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
• Molecular Weight: 28 kDa
• Expression Region: 31-104aa
• Protein Length: Full Length of Mature Protein
• Protein Sequence: DTTVSEPAPSCVTLYQSWRYSQADNGCAQTVTVKVVYEDDTEGLCYAVAPGQITTVGDGYIGSHGHARYLARCL
• Purity: Greater than 85% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Tendamistat

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Streptomyces tendae.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Streptomyces tendae.

Quick Database Links

UniProt

P01092