You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579899 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to BACE1 |
Target | BACE1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human BACE1 |
Protein Sequence | Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY |
UniProt ID | P56817 |
MW | 51 kDa |
Tested applications | IF, IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ASP2, BACE, HSPC104 |
Note | For research use only |
NCBI | NP_036236 |
Anti-BACE1 antibody IHC of human adrenal. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody orb579899 concentration 5 ug/ml.
Anti-BACE1 antibody IHC of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody orb579899 concentration 5 ug/ml.
Sample Type: Human Fetal Liver, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
Immunofluorescent BACE1 detection in mouse astrocytes (red fluorescence). Nuclei were stained with DAPI (blue fluorescence), Working dilution: 2-10 ug/ml.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
WB Suggested Anti-BACE1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Liver.
ICC, IF, IHC-Fr, IHC-P, WB | |
Canine, Gallus, Guinea pig, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |