ATXN10 Rabbit Polyclonal Antibody

• Catalog Number: orb585150
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATXN10
• Target: ATXN10
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: PARLSGVMVPAPIQDLEALRALTALFKEQRNRETAPRTIFQRVLDILKKS
• UniProt ID: Q9UBB4
• MW: 52kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: E46L, SCA10, HUMEEP
• Note: For research use only
• NCBI: NP_037368

WB Suggested Anti-ATXN10 Antibody, Titration: 1.0 ug/ml, Positive Control: 293T Whole Cell. ATXN10 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.