You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585150 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ATXN10 |
Target | ATXN10 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: PARLSGVMVPAPIQDLEALRALTALFKEQRNRETAPRTIFQRVLDILKKS |
UniProt ID | Q9UBB4 |
MW | 52kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | E46L, SCA10, HUMEEP |
Note | For research use only |
NCBI | NP_037368 |
WB Suggested Anti-ATXN10 Antibody, Titration: 1.0 ug/ml, Positive Control: 293T Whole Cell. ATXN10 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
FC, WB | |
Bovine, Canine, Equine, Human, Porcine, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC | |
Bovine, Canine, Equine, Human, Porcine, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
BF647 |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |