ATP7A Rabbit Polyclonal Antibody

• Catalog Number: orb574824
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATP7A
• Target: ATP7A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATP7A
• Protein Sequence: Synthetic peptide located within the following region: SSLFLKLYRKPTYESYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGL
• UniProt ID: Q04656
• MW: 163kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MK, MNK, DSMAX, SMAX3
• Note: For research use only
• NCBI: NP_000043

Lanes: Lane 1: 40 ug mouse endothelial firboblast lysate, Lane 2: 40 ug human HUVEC lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:2000, Gene Name: ATP7A.

WB Suggested Anti-ATP7A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HT1080 cell lysate, ATP7A is supported by BioGPS gene expression data to be expressed in HT1080.