ATP7A Rabbit Polyclonal Antibody

• Catalog Number: orb574823
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATP7A
• Target: ATP7A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATP7A
• Protein Sequence: Synthetic peptide located within the following region: MKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYQ
• UniProt ID: Q04656
• MW: 163kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MK, MNK, DSMAX, SMAX3
• Note: For research use only
• NCBI: NP_000043.3, NP_000043

Sample Tissue: Human Ovary Tumor, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-ATP7A Antibody Titration: 0.5 ug/ml, Positive Control: HepG2 cell lysate.