ATP6V0C Rabbit Polyclonal Antibody

• Catalog Number: orb579396
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATP6V0C
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATP6V0C
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 16 kDa
• Target: ATP6V0C
• UniProt ID: P27449
• Protein Sequence: Synthetic peptide located within the following region: VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG
• NCBI: NP_001685
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ATPL, VATL, VPPC, Vma3, ATP6C, ATP6L
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated whole cell extracts was loaded onto a 10-20% gradient SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended antibody dilution is 1 ug/ml to 3 ug/ml.

Sample Tissue: Human COLO205 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human RPMI 8226 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: ACHN, Antibody Dilution: 1.0 ug/ml. ATP6V0C is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells.

Sample Type: Human Lung, Antibody Dilution: 1.0 ug/ml.

Positive control (+): RPMI-8226 (N12), Negative control (-): U937 (N31), Antibody concentration: 1 ug/ml.

WB Suggested Anti-ATP6V0C Antibody Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate. ATP6V0C is strongly supported by BioGPS gene expression data to be expressed in OVCAR3.