You have no items in your shopping cart.
ATP6V0C Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Porcine, Rabbit, Rat, Sheep |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ATP6V0C |
| Target | ATP6V0C |
| Protein Sequence | Synthetic peptide located within the following region: VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG |
| Molecular Weight | 16 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−ATP6V0C Rabbit Polyclonal Antibody (Biotin) [orb2118346]
WB
Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Sheep
Rabbit
Polyclonal
Biotin
100 μlATP6V0C Rabbit Polyclonal Antibody (HRP) [orb2118344]
WB
Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Sheep
Rabbit
Polyclonal
HRP
100 μlATP6V0C Rabbit Polyclonal Antibody (FITC) [orb2118345]
WB
Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Sheep
Rabbit
Polyclonal
FITC
100 μlATP6V0C Rabbit Polyclonal Antibody [orb3068400]
IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl, 30 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated whole cell extracts was loaded onto a 10-20% gradient SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended antibody dilution is 1 ug/ml to 3 ug/ml.

Sample Tissue: Human COLO205 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human RPMI 8226 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: ACHN, Antibody Dilution: 1.0 ug/ml. ATP6V0C is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells.

Sample Type: Human Lung, Antibody Dilution: 1.0 ug/ml.

Positive control (+): RPMI-8226 (N12), Negative control (-): U937 (N31), Antibody concentration: 1 ug/ml.

WB Suggested Anti-ATP6V0C Antibody Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate. ATP6V0C is strongly supported by BioGPS gene expression data to be expressed in OVCAR3.
Documents Download
Request a Document
ATP6V0C Rabbit Polyclonal Antibody (orb579396)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review