Cart summary

You have no items in your shopping cart.

ATP6V0C Rabbit Polyclonal Antibody (Biotin)

ATP6V0C Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2118346

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2118346
CategoryAntibodies
DescriptionATP6V0C Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Sheep
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ATP6V0C
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW16kDa
UniProt IDP27449
Protein SequenceSynthetic peptide located within the following region: VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG
NCBINP_001685
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesATPL, VATL, VPPC, Vma3, ATP6C, ATP6L
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.