You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb588071 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ATP6V0A2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ATP6V0A2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 94kDa |
Target | ATP6V0A2 |
UniProt ID | Q9Y487 |
Protein Sequence | Synthetic peptide located within the following region: VKKICDCYHCHVYPYPNTAEERREIQEGLNTRIQDLYTVLHKTEDYLRQV |
NCBI | NP_036595 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | A2, RTF, TJ6, WSS, a2V, ARCL, J6B7, STV1, TJ6M, TJ Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: A549 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat, Yeast, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |