You have no items in your shopping cart.
ATP6V0A2 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat, Yeast, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ATP6V0A2 |
| Target | ATP6V0A2 |
| Protein Sequence | Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN |
| Molecular Weight | 98kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−ATP6V0A2 Rabbit Polyclonal Antibody [orb235031]
IF, WB
Human, Monkey, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl, 50 μlATPase H+ transporting V0 subunit a2 Antibody [orb556680]
WB
Human
Rabbit
Polyclonal
Unconjugated
100 μlATP6V0A2 polyclonal antibody [orb645702]
WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Anti-ATP6V0A2 antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Anti-ATP6V0A2 antibody IHC staining of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Application: IHC/Immunofluorescence, Species+tissue/cell type: A. untransfected HeLa cells, B. mATP6V0A2-FLAG transfected HeLa cells, C. mATP6V0A2 (partial) transfected HeLa cells, Primary antibody dilution: 1:250, Secondary antibody: Anti-rabbit AlexaFluor 488, Secondary antibody dilution: 1:1000.

Application: Western blotting, Species+tissue/cell type: HeLa cells, How many ug'sof tissue/cell lysate run on the gel: 1. 10 ug untransfected HeLa lysate, 2. 10 ug mATP6V0A2 (Partial) transfected HeLa lysate, 3. 10 ug mATP6V0A2-FLAG transfected HeLa lysate, 4. 10 ug mATP6V0A1-FLAG transfected HeLa lysate, Primary antibody dilution: 1:300, Secondary antibody: Anti-rabbit-HRP, Secondary antibody dilution: 1:1000.

ATP6V0A2 antibody - N-terminal region (orb578447) validated by WB using HeLa cells at 1:300.

Positive control (+): MCF7 (N10), Negative control (-): HEK293 (HEK293), Antibody concentration: 1 ug/ml.

Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0 ug/ml using anti-ATP6V0A2 antibody (orb578447).
Documents Download
Request a Document
Protocol Information
ATP6V0A2 Rabbit Polyclonal Antibody (orb578447)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





