ATP6V0A2 Rabbit Polyclonal Antibody

• Catalog Number: orb578447
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATP6V0A2
• Target: ATP6V0A2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATP6V0A2
• Protein Sequence: Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN
• UniProt ID: Q9Y487
• MW: 98kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: A2, RTF, TJ6, WSS, a2V, ARCL, J6B7, STV1, TJ6M, TJ
• Research Area: Cell Biology, Immunology & Inflammation, Signal Tr
• Note: For research use only
• NCBI: NP_036595
• Expiration Date: 12 months from date of receipt.

Anti-ATP6V0A2 antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Anti-ATP6V0A2 antibody IHC staining of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Application: IHC/Immunofluorescence, Species+tissue/cell type: A. untransfected HeLa cells, B. mATP6V0A2-FLAG transfected HeLa cells, C. mATP6V0A2 (partial) transfected HeLa cells, Primary antibody dilution: 1:250, Secondary antibody: Anti-rabbit AlexaFluor 488, Secondary antibody dilution: 1:1000.

Application: Western blotting, Species+tissue/cell type: HeLa cells, How many ug'sof tissue/cell lysate run on the gel: 1. 10 ug untransfected HeLa lysate, 2. 10 ug mATP6V0A2 (Partial) transfected HeLa lysate, 3. 10 ug mATP6V0A2-FLAG transfected HeLa lysate, 4. 10 ug mATP6V0A1-FLAG transfected HeLa lysate, Primary antibody dilution: 1:300, Secondary antibody: Anti-rabbit-HRP, Secondary antibody dilution: 1:1000.

ATP6V0A2 antibody - N-terminal region (orb578447) validated by WB using HeLa cells at 1:300.

Positive control (+): MCF7 (N10), Negative control (-): HEK293 (HEK293), Antibody concentration: 1 ug/ml.

Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0 ug/ml using anti-ATP6V0A2 antibody (orb578447).