You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331005 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ATG4D |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit |
Reactivity | Canine, Guinea pig, Human, Mouse, Porcine |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ATG4D |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 53kDa |
Target | ATG4D |
UniProt ID | Q86TL0 |
Protein Sequence | Synthetic peptide located within the following region: AQGAPELEQERRHRQIVSWFADHPRAPFGLHRLVELGQSSGKKAGDWYGP |
NCBI | NP_116274 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti APG4-D antibody, anti APG4D antibody, anti AU Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of 143B tissue using ATG4D antibody
Western blot analysis of HCT15 cell lysate tissue using ATG4D antibody
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating