Atat1 Rabbit Polyclonal Antibody

• Catalog Number: orb325028
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Atat1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit
• Reactivity: Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Atat1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46 kDa
• Target: Atat1
• UniProt ID: Q6MG11
• Protein Sequence: Synthetic peptide located within the following region: WPLNRAPRRATPPAHPPPRSSSLGNSPDRGPLRPFVPEQELLRSLRLCPP
• NCBI: NP_997663
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti 3110080J08Rik antibody, anti FLJ13158|Mec17|T
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse and Rat tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Multiple isoforms from 35-46 kDa are detectable.

WB Suggested Anti-Atat1 Antibody, Titration: 1.0 ug/mL, Positive Control: Rat Kidney.