C6orf134 Rabbit Polyclonal Antibody

• Catalog Number: orb325026
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATAT1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf134
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47 kDa
• Target: ATAT1
• UniProt ID: Q9H8X5
• Protein Sequence: Synthetic peptide located within the following region: MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL
• NCBI: NP_079185
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DAQB-47P19.10 antibody, anti DKFZp547J097 ant
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The canonical isoform of 47 kDa is present as well as a second isoform around 36 kDa.

Positive control (+): Human Ovary (OV), Negative control (-): Human lung (LU), Antibody concentration: 1 ug/mL.

WB Suggested Anti-C6orf134 Antibody Titration: 2.5 ug/mL, Positive Control: HepG2 cell lysate, ATAT1 is supported by BioGPS gene expression data to be expressed in HepG2.