You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584607 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ASNS |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ASNS |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 64kDa |
Target | ASNS |
UniProt ID | P08243 |
Protein Sequence | Synthetic peptide located within the following region: SVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADR |
NCBI | NP_001664 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | TS11, ASNSD Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Lane 1: 40 ug Human Liver lysate, Lane 2: 40 ug Mouse Liver lysate, Lane 3: 40 ug Rat Liver lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit secondary antibody conjugated with Alexa Fluor 647, Secondary Antibody dilution: 1:2500.
WB Suggested Anti-ASNS Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Lung.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IP, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |