ASNS Rabbit Polyclonal Antibody

SKU: orb584607

Description

Rabbit polyclonal antibody to ASNS

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ASNS
• Target: ASNS
• Protein Sequence: Synthetic peptide located within the following region: SVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADR
• Molecular Weight: 64kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

TS11, ASNSD

Sample Type: Lane 1: 40 ug Human Liver lysate, Lane 2: 40 ug Mouse Liver lysate, Lane 3: 40 ug Rat Liver lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit secondary antibody conjugated with Alexa Fluor 647, Secondary Antibody dilution: 1:2500.

WB Suggested Anti-ASNS Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Lung.

Quick Database Links

Gene Symbol

ASNS

UniProt

P08243

RefSeq (Protein):NP_001664