ASGR2 Rabbit Polyclonal Antibody

• Catalog Number: orb574839
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ASGR2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Porcine
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ASGR2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 34kDa
• Target: ASGR2
• UniProt ID: P07307
• Protein Sequence: Synthetic peptide located within the following region: STLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPV
• NCBI: NP_001172
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HL-2, HBXBP, ASGPR2, ASGP-R2, CLEC4H2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human HepG2, Antibody dilution: 1.0 ug/ml.

Human Spleen

WB Suggested Anti-ASGR2 Antibody Titration: 4.0 ug/ml, Positive Control: HepG2 cell lysate, ASGR2 is supported by BioGPS gene expression data to be expressed in HepG2.