ARID5A Rabbit Polyclonal Antibody

• Catalog Number: orb325614
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ARID5A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARID5A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 64kDa
• Target: ARID5A
• UniProt ID: Q03989
• Protein Sequence: Synthetic peptide located within the following region: LWKNVYDELGGSPGSTSAATCTRRHYERLVLPYVRHLKGEDDKPLPTSKP
• NCBI: NP_997646
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MRF-1 antibody, anti RP11-363D14 antibody, an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human NCI-H226, Antibody Dilution: 1.0 ug/mL.

Sample Type: 721_B, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Positive control (+): MCF7 (N10), Negative control (-): HeLa (HL), Antibody concentration: 1 ug/mL.

WB Suggested Anti-ARID5A Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate, ARID5A is supported by BioGPS gene expression data to be expressed in 721_B.