ARID5A Rabbit Polyclonal Antibody

• Catalog Number: orb325615
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ARID5A
• Target: ARID5A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ARID5A
• Protein Sequence: Synthetic peptide located within the following region: MAAGLMHFPPTSFDSALRHRLCPASSAWHAPPVTTYAAPHFFHLNTKL
• UniProt ID: Q03989
• MW: 64kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti MRF-1 antibody, anti RP11-363D14 antibody, an
• Research Area: Epigenetics & Chromatin, Stem Cell & Developmental
• Note: For research use only
• NCBI: NP_997646

Positive control (+): HepG2 (HG), Negative control (-): HeLa (HL), Antibody concentration: 1 ug/mL.

Sample Tissue: Human 721_B, Antibody Dilution: 1.0 ug/mL.

Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0 ug/mL using anti-ARID5A antibody (orb325615).

WB Suggested Anti-ARID5A Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate, ARID5A is supported by BioGPS gene expression data to be expressed in 721_B.