ARHGEF19 Rabbit Polyclonal Antibody

• Catalog Number: orb581960
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ARHGEF19
• Target: ARHGEF19
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Mouse, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARHGEF19
• Protein Sequence: Synthetic peptide located within the following region: RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS
• UniProt ID: Q8IW93
• MW: 89kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: WGEF
• Note: For research use only
• NCBI: NP_694945
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human RPMI 8226 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-ARHGEF19 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.