You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581960 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ARHGEF19 |
Target | ARHGEF19 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Equine, Mouse, Porcine, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ARHGEF19 |
Protein Sequence | Synthetic peptide located within the following region: RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS |
UniProt ID | Q8IW93 |
MW | 89kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | WGEF |
Note | For research use only |
NCBI | NP_694945 |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human RPMI 8226 Whole Cell, Antibody dilution: 1 ug/ml.
WB Suggested Anti-ARHGEF19 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Equine, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
HRP |