Cart summary

You have no items in your shopping cart.

ARHGEF19 Rabbit Polyclonal Antibody (HRP)

ARHGEF19 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2108219

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2108219
CategoryAntibodies
DescriptionARHGEF19 Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityBovine, Equine, Human, Mouse, Porcine, Rat
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ARHGEF19
Protein SequenceSynthetic peptide located within the following region: RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS
UniProt IDQ8IW93
MW89kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesWGEF
NoteFor research use only
NCBINP_694945
Expiration Date12 months from date of receipt.