ARF6 Rabbit Polyclonal Antibody

• Catalog Number: orb582398
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ARF6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARF6
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 20 kDa
• Target: ARF6
• UniProt ID: P62330
• Protein Sequence: Synthetic peptide located within the following region: REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG
• NCBI: NP_001654
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DKFZp564M0264
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): HeLa Cell Lysate (HL), Antibody concentration: 1 ug/ml.

IHC Information: Paraffin embedded brain, cerebellum tissue, tested with an antibody Dilution of 5 ug/ml.

WB Suggested Anti-ARF6 Antibody Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate. ARF6 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.