You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb582398 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ARF6 |
| Target | ARF6 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ARF6 |
| Protein Sequence | Synthetic peptide located within the following region: REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG |
| UniProt ID | P62330 |
| MW | 20 kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | DKFZp564M0264 |
| Research Area | Epigenetics & Chromatin, Molecular Biology, Neuros Read more... |
| Note | For research use only |
| NCBI | NP_001654 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): HeLa Cell Lysate (HL), Antibody concentration: 1 ug/ml.

IHC Information: Paraffin embedded brain, cerebellum tissue, tested with an antibody Dilution of 5 ug/ml.

WB Suggested Anti-ARF6 Antibody Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate. ARF6 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Human, Porcine, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Equine, Human, Porcine, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review