ARF1 antibody

• Catalog Number: orb330535
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ARF1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IP, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Yeast, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARF1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 21kDa
• Target: ARF1
• UniProt ID: P61204
• Protein Sequence: Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA
• NCBI: NP_001649
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PVNH8
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoprecipitation of mouse Brain lysate using ARF1 antibody

Immunoprecipitation of rat brain tissue using ARF1 antibody

Immunohistochemical staining of mouse brain tissue using ARF1 antibody

Western blot analysis of human Fetal Lung tissue using ARF1 antibody

Western blot analysis of human, mouse Brain tissue using ARF1 antibody