Cart summary

You have no items in your shopping cart.

ARC Rabbit Polyclonal Antibody

SKU: orb576004

Description

Rabbit polyclonal antibody to ARC

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Goat, Guinea pig, Mouse, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ARC
TargetARC
Protein SequenceSynthetic peptide located within the following region: ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF
Molecular Weight45 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

hArc, Arg3.1

Similar Products

  • E cadherin Rabbit Polyclonal Antibody [orb156677]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Mouse, Porcine, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • E-cadherin/Cdh1 Rabbit Polyclonal Antibody [orb1972562]

    ELISA,  FC,  IF,  IHC,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • E cadherin Rabbit Polyclonal Antibody (FITC) [orb15536]

    FC

    Bovine, Canine, Equine, Gallus, Mouse, Porcine, Rat

    Human

    Rabbit

    Polyclonal

    FITC

    100 μl
  • E cadherin Rabbit Polyclonal Antibody [orb11101]

    FC,  WB

    Bovine, Canine, Equine, Gallus, Mouse, Porcine, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Myp rabbit pAb Antibody [orb765756]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

ARC Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.8 ug/ml of the antibody was used in this experiment.

ARC Rabbit Polyclonal Antibody

Sample Tissue: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

ARC Rabbit Polyclonal Antibody

Sample Type: 293T, Antibody Dilution: 1.0 ug/ml.

ARC Rabbit Polyclonal Antibody

Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml.

ARC Rabbit Polyclonal Antibody

Sample Type: Hela, Antibody Dilution: 1.0 ug/ml.

ARC Rabbit Polyclonal Antibody

Positive control (+): 293T Cell Lysate (2T), Negative control (-): Human Stomach Tumor (T-ST), Antibody concentration: 1 ug/ml.

ARC Rabbit Polyclonal Antibody

Immunohistochemistry with Adrenal tissue at an antibody concentration of 5 ug/ml using anti-ARC antibody (orb576004).

ARC Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

ARC Rabbit Polyclonal Antibody

WB Suggested Anti-ARC Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_056008

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

ARC Rabbit Polyclonal Antibody (orb576004)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry