APOBEC3D Rabbit Polyclonal Antibody

SKU: orb577929

Description

Rabbit polyclonal antibody to APOBEC3D

Research Area

Molecular Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3D
• Target: APOBEC3D
• Protein Sequence: Synthetic peptide located within the following region: SYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAE
• Molecular Weight: 47 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

A3D, A3DE, ARP6, APOBEC3E, APOBEC3DE

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The canonical is not observed. An isoform containing the peptide sequence is present at 23 kDa.

Rabbit Anti-APOBEC3D Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-APOBEC3D Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

APOBEC3D

UniProt

Q96AK3

RefSeq (Protein):NP_689639