You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577929 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to APOBEC3D |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3D |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 47 kDa |
Target | APOBEC3D |
UniProt ID | Q96AK3 |
Protein Sequence | Synthetic peptide located within the following region: SYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAE |
NCBI | NP_689639 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | A3D, A3DE, ARP6, APOBEC3E, APOBEC3DE Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The canonical is not observed. An isoform containing the peptide sequence is present at 23 kDa.
Rabbit Anti-APOBEC3D Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-APOBEC3D Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Porcine, Rabbit | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |