You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324527 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to bK150C2.9 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Porcine, Rabbit |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human APOBEC3D |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 22kDa |
Target | APOBEC3D |
UniProt ID | Q6ICH2 |
Protein Sequence | Synthetic peptide located within the following region: CPECAGEVAEFLARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVK |
NCBI | XP_005261394.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | A3D, A3DE, ARP6, APOBEC3E, APOBEC3DE Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Human | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |